PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000813.1_g00027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ZF-HD
Protein Properties Length: 1103aa    MW: 122598 Da    PI: 8.1683
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000813.1_g00027.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.16.4e-31800853357
              ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                               +rY+eCl+NhA+s+Gg ++DGCgEfmp+ geegt+a+lkCaAC+CHRnFHR+e+
  Itr_sc000813.1_g00027.1 800 VIRYRECLRNHAVSIGGSVTDGCGEFMPA-GEEGTVASLKCAACNCHRNFHRQET 853
                              689*************************9.999*******************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF567842.82E-61225411IPR023214HAD-like domain
PfamPF057613.7E-70227410IPR008380HAD-superfamily hydrolase, subfamily IG, 5'-nucleotidase
Gene3DG3DSA:3.40.50.10001.9E-6235254IPR023214HAD-like domain
SuperFamilySSF567849.42E-73440754IPR023214HAD-like domain
PfamPF057612.0E-91440753IPR008380HAD-superfamily hydrolase, subfamily IG, 5'-nucleotidase
Gene3DG3DSA:3.40.50.10001.9E-6444512IPR023214HAD-like domain
Gene3DG3DSA:3.40.50.10001.9E-6561615IPR023214HAD-like domain
ProDomPD1257741.0E-21796852IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.1E-29801853IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.3E-28802852IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.643803852IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.603.4E-2510171087IPR009057Homeodomain-like
SuperFamilySSF466891.02E-1210191087IPR009057Homeodomain-like
TIGRFAMsTIGR015652.9E-2610251083IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1103 aa     Download sequence    Send to blast
MRLLRRVRSG VFSVKTPDTA RLPRHLVVSN NYSLGGSDLG GSISIFRVIL NHLAVEILIR  60
VQKWFAFKGN MRLAGERSVS FCLSGIPSLP PPDSLSFISR NLRFRVGPFR SRGTRIRYKG  120
ASLRLISSSK CLPLGDDFIH LLSILGALRG LVLLIEAYKL EHNSVLSVGF TLDPEGRNQL  180
HTRSAMDGIR LDGNTTQLEI DNGAFGDQRS CIWSSPGGCK IDIGKQIFCN RSLNMNNIVA  240
VGFDMDYTLA QYKPETFESL AYEGTVKKLV YDLGYPEELL QWSFDWSYMV RGLVVDKKRG  300
NILKMDRHKY VKVAYHGFRQ MSKGDKIATY GNTLIQDSFD EPDYVLIDTL FSLAGAYLFA  360
QLVDFKDNNP GRIPEESDYA CIYKDIHAAV DLCHRDGTLK QTVAQDPKRH FGTLNPWMIM  420
YLCSSQGFFS EERVLLSFLM HSYINDDTSI VPMLKMLRES GRATFLVTNS LWDYTNVVMN  480
FLCGPKSTDC HSTLTFEWLQ YFDVVITGSA KPGFFNEENR ANLFGVDPKT GMLMNTDNGT  540
PMAQVGSTSI RLPIESLTEG CRVFQGGSVG HLHKLLNIES SSQILYVGDH IYGDILRSKK  600
ALGWRTMLVV PELEREVELL WELKDTRKHL QSLRSERDHI EDDIDHLKWR LKSQGADDAE  660
KERLSSKLVE LQVGIFDSHR EQVRVVHKQT QRECHKKFHK VWGQLMKTGY QNSRFAHQVE  720
RFACLYTSQV TNLSLYSPDK YYRPSEDFMP HEFDILSLSR MGLIGEEKDI GDGGGFQAGV  780
DDAPPPLPEN QENSVAGTRV IRYRECLRNH AVSIGGSVTD GCGEFMPAGE EGTVASLKCA  840
ACNCHRNFHR QETPHGDGGA PPPPNPPALP SFASMTHRHN AWASLAAQSP KTFGGAPPPT  900
TAGAATAAPA TVASSFQEPN FNPHKCFTSA PFPSPATATA ATAAPVANSF QEPNFNPHKC  960
FTSAPFPSPA TAAAATAVPV PAAVDTSFQE SIFNPHKCFT SAPFPSPSTT AAATATAPAP  1020
ETRGKKRFRT KFTAEQKEKM TEFADKIGWR IPREEENING VERFCGEIGV KRQIFKVWMH  1080
NNKSSAKPNA TSPSQSSSSS INN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2bde_A2e-712267555459cytosolic IMP-GMP specific 5'-nucleotidase
4g63_A2e-712267555459Cytosolic IMP-GMP specific 5'-nucleotidase
4ohf_A2e-712267555459Cytosolic IMP-GMP specific 5'-nucleotidase
4ohf_B2e-712267555459Cytosolic IMP-GMP specific 5'-nucleotidase
4ohf_C2e-712267555459Cytosolic IMP-GMP specific 5'-nucleotidase
4ohf_D2e-712267555459Cytosolic IMP-GMP specific 5'-nucleotidase
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4682392e-44CU468239.4 S.lycopersicum DNA sequence from clone SL_MboI-124K5 on chromosome 4, complete sequence.
GenBankHG9754432e-44HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBankHG9755162e-44HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009760250.10.0PREDICTED: 5'-nucleotidase domain-containing protein 4 isoform X1
TrEMBLA0A0V0INQ60.0A0A0V0INQ6_SOLCH; Putative cytosolic purine 5'-nucleotidase-like
STRINGSolyc04g080430.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.13e-25homeobox protein 33